DPCstruct | MC5395
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 103 ± 10 aa |
| Standard deviation of domain lengths | 9.85 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 44.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A016X2M9 | 187-289 | SSSNDGVIMADQLCGIWFLTMMNQEELLSEKQITSALKSIYAHNVKEFAFGEMGPVNGIYEDGSVDISSIQSEEVWTGIGYSLASFM… |
| A0A673BSF8 | 6-101 | SGRDLSNSVMSDQCAGHWFLRASGLGDGEFKEKIRSALKSVYELNVMSFAGGHMGAVNGMRPEGVPDRSSVQSDEVWIGVVYGLAAT… |
| M8B2P7 | 1045-1148 | None |
| H2YFL5 | 84-195 | None |
| A0A3P6UUV7 | 61-188 | None |
| A0A183NWR6 | 922-1042 | None |
| A0A2G3CRW6 | 419-528 | None |
| A0A6P6FNR2 | 17-122 | None |
| A0A6F9C9C0 | 365-483 | None |
| A0A1V5MJY8 | 181-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.