DPCstruct | MC53948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 136 ± 15 aa |
| Standard deviation of domain lengths | 14.71 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 49.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0111 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J0EXN9 | 6-132 | WFLVVSWIMSPFVFNPSGFDWLETVYDFDDFMNWIWYIGVLVKADQSWETWWYEEQNHLRTTGVWGKLLEIILDLRFFFLQYGIVYR… |
| A0A834ZL83 | 109-257 | ISSWFLVVSWIMAPFVFNPSGFDWLKAVYDFDEFMNWIWYRSGVFSKAEESWETWWYEEQGHLRMTGLWGKLLEIILDLRFFFFQYG… |
| A0A1D6NNZ3 | 1670-1815 | None |
| A0A287KW22 | 220-368 | None |
| A0A834X3U2 | 47-190 | None |
| A0A6P8BWE2 | 2-153 | None |
| A0A2R6QQ74 | 660-796 | None |
| A0A287PX02 | 299-444 | None |
| A0A1D6NG47 | 1520-1669 | None |
| A0A446WXF8 | 105-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.