DPCstruct | MC53941
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 312 ± 60 aa |
| Standard deviation of domain lengths | 59.82 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 68.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J2K7N3 | 37-320 | NQMMEENEKIKGILPRRSIKEPMLSNRKCLLIDRGMDSDTDVEYCPSDDEETEINIHQELLKKPIREQITWNTHYLQPEREDEKTLI… |
| A0A834JY58 | 904-1251 | KRDRRRDNVAKRLVKLLVESRRYSNPDKFPSDLIFSSKQRPLLTCQRLRSILPLDSYNLIAPLLGIPEYHPRFSSIHEKLKPAKKPS… |
| A0A2A3ERP6 | 4-236 | None |
| B4GL08 | 1-195 | None |
| A0A7M7L4R2 | 852-1191 | None |
| A0A1A9UZR3 | 82-470 | None |
| E2C094 | 43-290 | None |
| A0A5E4PVH7 | 95-346 | None |
| A0A2H1V726 | 50-312 | None |
| A0A154P6C7 | 462-797 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.