DPCstruct | MC5394
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 104 ± 10 aa |
| Standard deviation of domain lengths | 10.32 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1V881 | 2-92 | QKIKNVNGSSRFSSPAGYNTWLDYWEAKSGKTASRCSATDCHQSGRWNLVGAHVQKVYGYDNSWYIVPLCRGCNTRTDEFYVDETLV… |
| A0A370QS26 | 3-91 | VSGENWGNKVGTTERDCSCGSWMNHWVKMTGKAWPMACSVEGCDEKATLGAHVYHANVEGERIVPMCAGCNKKGEKFNLKGGTSVPS… |
| A0A7M5XEJ4 | 138-240 | None |
| A0A061R2X4 | 46-142 | None |
| A0A6S7GVS6 | 170-269 | None |
| A0A0K2X362 | 8-102 | None |
| A0A519DJZ2 | 4-127 | None |
| A0A1F9WKV0 | 12-113 | None |
| C1MPJ2 | 11-128 | None |
| A0A3M7RPI4 | 27-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.