DPCstruct | MC53935
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 315 ± 49 aa |
| Standard deviation of domain lengths | 48.82 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 16.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T0V831 | 47-331 | HELIYNWVLSSFCKPYIAILWQTVYDHWEQIVSDISGKVDIVFSKTMSFDSVGLQEFIKDVYSFEQPADFSVKITNKAEVLVNCGCA… |
| A0A359MEN9 | 65-386 | SMINNKVDEPVPVNPEGHLANGAHRLAAALYRQRPINIRNTTKKENYPIEADYKVFLRKGLQKHILGRTALEYAKLKPNTHVICLFP… |
| A0A2E4FEJ4 | 4-346 | None |
| F7K8G2 | 197-521 | None |
| A0A2M6W8J7 | 4-343 | None |
| A0A0M5MJF9 | 27-371 | None |
| A0A2W4RXC0 | 128-468 | None |
| A0A4U8S6W7 | 143-458 | None |
| A0A1Q9D1N5 | 14-217 | None |
| A0A1H7M3V3 | 6-357 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.