DPCstruct | MC53930
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 98 ± 9 aa |
| Standard deviation of domain lengths | 9.44 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I4BI92 | 4-105 | TSIPDSVALPPGAYTQDTWQAAEPQPYRIILGGDRTIAGHRAVVSPSAVQWADGSVDDGRTEAPHVYAFNLEESNPLTTDQARELAA… |
| A0A1X0A187 | 18-105 | LNAAVPLPDSFAEGGVWEDDEDGSWTRSLFGIEHGAAVRVSVGAFQSEDGRILEPNVWVEIDKQFGGLDPAGARQVAADLLRAADEVE |
| A0A1E8Q2U1 | 1-87 | None |
| A0A1X0H076 | 6-79 | None |
| A0A498PHZ8 | 1-99 | None |
| A0A5C7XRF6 | 1-93 | None |
| A0A100WD08 | 40-147 | None |
| A0A5P8ZQZ1 | 22-138 | None |
| A0A7I7M761 | 48-149 | None |
| A0A1E3S3A6 | 57-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.