DPCstruct | MC5393
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 78 ± 7 aa |
| Standard deviation of domain lengths | 7.42 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E2WX95 | 187-264 | DPQKKMLASQIYLVKGVDRGRNAWYYVLVDRLKVKLFLKALNDDIIHLENYGKILYSAYGDEPPKEITDALKDEYGID |
| A0A0J5T7R6 | 4-87 | ISFLNRLISREGHCVQKLKAKDSTGQWAYYFVHVPPNKEKAFMTAICGEGTIDFEDFGTVIASNYGEGPTAETCALLKHRFGFN |
| A0A286IHT2 | 16-98 | None |
| A0A844MZE3 | 535-619 | None |
| A0A6V7WXN2 | 162-237 | None |
| A0A821HL77 | 10-95 | None |
| A0A4P5SNJ3 | 50-127 | None |
| A0A1Q3PDU8 | 7-77 | None |
| A0A6V7XQ33 | 76-147 | None |
| A0A350Y5E3 | 108-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.