DPCstruct | MC53927
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 84 ± 12 aa |
| Standard deviation of domain lengths | 12.40 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 92.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842ULZ0 | 29-105 | KLMTNLKQNAEKEIKRMQKVFDSLEVKKGNQFYDFAKNYFDDSKHFLEKKKYIEAFEAAVIAWAYIDFGLKLNYFSV |
| A0A7C0UVK7 | 1-79 | MSTEEKLREEIKKWMKRLEEAVEKTRALNNKGGEFLANIKAYQSDSLHFYQKGDLIRSFEALIWAWAYLEIGKDIGILG |
| A0A843JWM1 | 10-86 | None |
| A0A3M1F7W5 | 18-98 | None |
| A0A7J3FED8 | 32-103 | None |
| A0A497T4M7 | 39-126 | None |
| A0A497SIZ9 | 1-112 | None |
| A0A0B3ARY2 | 117-200 | None |
| A0A2P6W0H3 | 23-92 | None |
| A0A2G9PB50 | 75-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.