DPCstruct | MC53917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 251 ± 30 aa |
| Standard deviation of domain lengths | 30.33 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D9PGS7 | 405-680 | VYSLDEAGSVYKAPNHLRGVPVEKVTEDSLYWEKSWDSLDDFIAYEEEERFLKEKYQAMKDAEPNNTDIRKKAKSHQDNMSKHVKIR… |
| A0A168BL96 | 9-277 | VYKHDAADTVYLAPASLCGVPVEKITETSPYWESSWHSLDAFLAQEEEEKARKEEYQSLKNCHPEDVAIRRKAKFHQDNMSKHVKIR… |
| A0A367LN20 | 1-247 | None |
| T5A550 | 230-459 | None |
| S3BYT4 | 560-791 | None |
| J4KL52 | 212-427 | None |
| N4VF40 | 436-680 | None |
| X0GPI0 | 2-217 | None |
| J5JDL5 | 1-182 | None |
| A0A167LIT9 | 50-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.