DPCstruct | MC53916
Metacluster Properties and Pfam Annotations
| Number of structural domains | 348 |
|---|---|
| Mean domain length (aa) | 235 ± 57 aa |
| Standard deviation of domain lengths | 56.57 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 89.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 14.92 |
| Pfam Score | 98.48 |
| Assigned Pfam label(s) | CL0043- CL0142- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D6KJF0 | 198-453 | EITSPYTINVIGDYNIQGDTFVLERYMEKMGVQIIAHFTGNGTYDALRGMHRAQLNVTNCARSAGYIANELKKRYGIPRMDVDTWGF… |
| D5DZP4 | 26-234 | GVEVVSEDDLEKIMELKPDLIIAGSEMKNIKKLNKIAPTVVFTWGKLDYLNQQIEIGKLLNKEKEAKEWVNDFQKRAAAAGEAIRKK… |
| A0A6N7Y3Q2 | 223-479 | None |
| A0A0P6XY76 | 8-228 | None |
| A0A1Q9CN12 | 109-529 | None |
| A0A2P8EQ02 | 387-656 | None |
| A0A2R6CQH4 | 52-309 | None |
| A0A7S2UHM7 | 2-199 | None |
| A0A1V5B7W5 | 365-794 | None |
| A0A378F337 | 2-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.