DPCstruct | MC53915
Metacluster Properties and Pfam Annotations
| Number of structural domains | 248 |
|---|---|
| Mean domain length (aa) | 287 ± 71 aa |
| Standard deviation of domain lengths | 70.50 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 72.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.59 |
| Pfam Score | 97.02 |
| Assigned Pfam label(s) | PF01184- PF05890- CL0257- CL0184- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A123VRN5 | 2-175 | TWVTNQSVVLQALLGGLFTWFCTIMGSAVVFFFKTVSRRLLDTMLGFAAGVMIAASFWSLLAPSIEYAESSYGNLAWIPAAVGFAAG… |
| A0A4Z2BNB3 | 97-399 | LTITRRRAIGSTLLISAAPFLILFLIPVQSNSDQHQNLLKILLSFASGGLLGDAFLHLIPHALAPHSHHGDDHGHAHKSEESHGHSH… |
| A0A146HJZ8 | 2-332 | None |
| A0A7S4SAW9 | 92-345 | None |
| A0A343TGZ3 | 3-166 | None |
| A0A287XHI9 | 2-248 | None |
| A0A1S3Q7N6 | 3-228 | None |
| A0A2K5NDM6 | 137-466 | None |
| A0A446JR54 | 46-232 | None |
| A0A7E4W563 | 2-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.