DPCstruct | MC53910
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 729 ± 66 aa |
| Standard deviation of domain lengths | 66.38 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 67.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0662 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9JHT1 | 16-627 | CPVEDKSVGSKQDQGDNNDLGPRVADWRFGPAQVWYDMLEVPETGDGFNYGFKLKDKVEDEDDSGRGEEFPDDSYLMVSQLHWEDEV… |
| A0A4Z2AYJ9 | 1-714 | MMAPVESKFSQACGDGDKETESRPKVAEWRYGPAQLWYDMLGVSEDGSNFNYGFKLRDFLPKEPEKPDVPQENTETSQKEQDSHDGA… |
| A0A1D2MEU3 | 2-734 | None |
| A0A1Y2W5L0 | 73-873 | None |
| M5BSV7 | 1-783 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.