DPCstruct | MC5391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 67 ± 6 aa |
| Standard deviation of domain lengths | 6.04 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 46.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0224 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090PBT7 | 2-68 | DELKGDLDIPMSIQAAGVNEADFLAKVDELAVEAFDDQCTGANPRYPLITELKEVLLAAYYGKAFVE |
| D3VH96 | 5-71 | EEIKSQLDIPASIRETGVQESDFLAKIDKLAEDAFDDQCTGANPRYPLISELKQLLLDSFYGRKFTE |
| A0A484X867 | 252-327 | None |
| R5XNU9 | 564-628 | None |
| A0A7S4E0A9 | 84-150 | None |
| A0A1V3XW73 | 5-67 | None |
| A0A7I7L524 | 93-167 | None |
| A0A3S4GCV5 | 1-54 | None |
| A0A850R0G3 | 620-685 | None |
| A0A1E3S9H5 | 40-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.