DPCstruct | MC5390
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 69 ± 5 aa |
| Standard deviation of domain lengths | 5.28 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5F1TQK9 | 3-62 | VETKARTSLRLFRNGARNFSRIKPHDYLVIRIGFRWRLLSKNNGKSWDLLTHETYNREAA |
| D3VA06 | 12-83 | LHVPVTAPLSFRRKAQYQVKCYRRGQRNYVRLKEKGTGYLKINVGLFWRLLSRDSGQSWELMHHERYNNEIR |
| A0A2W5S6W6 | 1-67 | None |
| A0A8B3ZS38 | 85-153 | None |
| A0A433G5A4 | 1-71 | None |
| D0XHJ7 | 171-237 | None |
| A0A1V3GYY5 | 3-71 | None |
| A0A366FCR3 | 130-196 | None |
| A0A2X5PJR9 | 2-75 | None |
| A0A7H4MYM1 | 9-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.