DPCstruct | MC539
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 153 ± 30 aa |
| Standard deviation of domain lengths | 30.22 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 73.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0079 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I8SHS0 | 129-283 | KLLLSLLLALCWASCQGNQIKCKDPSEEYLKNKLFRHAPDAQILLFKPDISPDQELRTCPKSVNHSSTLIQERSISPWSYRINENVN… |
| A0A5J5DAR3 | 6-138 | DHELQAAAWRKLNSHYPKLVEPRVAAAPDSPVSCPVEYFPQHFHERSLSPWRYELVPKKDHFPSTYAEARCLCLGCILIQNKSQPME… |
| A0A2G8LPA6 | 53-196 | None |
| W5M210 | 1-106 | None |
| A0A3Q0JGE4 | 159-333 | None |
| A0A6I9IWU8 | 1-112 | None |
| A0A7U3MCB1 | 26-199 | None |
| A0A667HLX5 | 268-434 | None |
| A0A835TST9 | 10-168 | None |
| R7TRH3 | 11-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.