DPCstruct | MC53893
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 87 ± 4 aa |
| Standard deviation of domain lengths | 3.79 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 76.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 53.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813XTM9 | 34-116 | QIEPNVLLKLKKDTCTSTARSILKFKYPSPTISYKLADMDKKLVDAIVFYSKQCHPDDKRKDSHVRKAMSNYFSLIRHNKKLK |
| A0A821IIT2 | 1-92 | MDALKMSEEQLKKCHKKTQTATARCLIRFIFPTPEPSFKLSNVDKFIIDGIIKYSKYVNPVDNASGVEVRRAIGYYFSSSAYNKKKE… |
| A0A817N2G1 | 107-196 | None |
| A0A819EY52 | 164-250 | None |
| A0A816ECG6 | 109-197 | None |
| A0A815XJ61 | 1-83 | None |
| A0A816AXM4 | 98-178 | None |
| A0A817HPM2 | 308-397 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.