DPCstruct | MC53892
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 170 ± 15 aa |
| Standard deviation of domain lengths | 15.28 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11573 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821IEV7 | 1-157 | MLYPIVGYSNYASILWRLHYIKLKFHQTAPLPFDRAQVQPQTELFCYVIKQLNSRDLAFSLVGIARNVKQRITAIEESLADLLIWNI… |
| A0A1A8G974 | 231-404 | LLPVVNNSGAICNSWKLDPTTLRFHLRGMLPYDKDLFEPQTGLLRYVLEQPYSREMVCNMLGLNKQQKQRCPVLEEQLVDLVVYAME… |
| A0A817HLQ3 | 1-155 | None |
| A0A7J7WW29 | 143-320 | None |
| T1KM15 | 163-353 | None |
| A0A1B0BXH5 | 223-420 | None |
| A0A814SQC4 | 81-237 | None |
| A0A336LHK9 | 212-378 | None |
| T1KIW4 | 144-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.