DPCstruct | MC5389
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 51 ± 5 aa |
| Standard deviation of domain lengths | 5.46 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 64.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8AVK5 | 116-170 | MMLRHLGWTEAADLIIKGTNGAIKAKTVTYDFERLMEGATLVSSSGFGEALIKHM |
| A0A7V1ZHL3 | 6-60 | MMLRYLGWTEAADLVVKGLEKAVADKQVTYDLHRQMEGATLVSCSGFGEAIVARM |
| A0A6L5VKY8 | 3-46 | None |
| A0A7X8ZGD2 | 190-246 | None |
| A0A1M7L0D9 | 40-88 | None |
| A0A1V5K451 | 6-59 | None |
| A0A4P7IZS6 | 2-55 | None |
| A0A2V3KF52 | 1-41 | None |
| A0A6I6DPG9 | 8-63 | None |
| A0A0Q0KL49 | 35-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.