DPCstruct | MC53888
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 154 ± 26 aa |
| Standard deviation of domain lengths | 26.48 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0111 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821G8L5 | 2-165 | GLYYSYFKEIAIDSPSFIEGFLSIISDNRTEAPTTINVLERFNLYPEVLLSLIYRTMNSRGMLTELCYQVDRGQTMSPVLSCEGHKE… |
| A0A6P4ZH32 | 82-247 | MGLYYSYFKTIAESRTFLEGLHAVMYDNMTEYPTTINVLKRFNLYPEVVLAACYRAYEAVMGMFDIPTKLCWTVNRGEGMSPVQSCE… |
| A0A452T6W1 | 5-177 | None |
| A0A6F9CBF6 | 125-275 | None |
| A0A6F9CQY1 | 1-197 | None |
| A0A0V0Y252 | 80-246 | None |
| A0A3P7EG25 | 3-121 | None |
| A0A813DFI8 | 23-182 | None |
| A0A7R8CFV4 | 226-409 | None |
| A0A267E8B6 | 94-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.