DPCstruct | MC53881
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 247 ± 42 aa |
| Standard deviation of domain lengths | 42.09 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 50.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X2CA61 | 28-262 | MAGNPYTESGELFKIPDMLANRADIYNLGEVLGGMDDAFALSYIENSLTSNSVLAPLALRDLNDLYLFVDKAMGKSVSTNSLSYPYS… |
| X0RYJ4 | 1-250 | MLANRADIYNLGDIMSGMEEVFALSYIENSLTSNSVLAPLANRDLSDVHRLIKMAKTDNANLAQAQSSDLTYPYSTSEINEIIAILR… |
| A0A1F9N1S3 | 1-269 | None |
| A0A4Q2YT69 | 18-262 | None |
| A0A1B8TBZ9 | 52-322 | None |
| A0A4Q2X0L3 | 117-354 | None |
| A0A7Z8L4J6 | 2-184 | None |
| A0A7C8DA94 | 1-298 | None |
| A0A858RR76 | 974-1194 | None |
| A0A3M2F4S8 | 253-573 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.