DPCstruct | MC5388
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 397 ± 39 aa |
| Standard deviation of domain lengths | 39.31 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 68.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 21.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R6JCE1 | 11-418 | SLIGVRFLWSNGERLAGCSWGITQADGKVIQGKLDSKSFLSQVIAGREHKVQLHPGFEPKKQPSASRTELKRILNVILNVERLEADR… |
| A0A438L6M5 | 28-357 | RAPPPVPYNGDFYSQPKRTIERENPTSTCHIGLKFIWDNGEGLGCDLPCVLTPANGEPIRTRLDEYSRFVGSIPDGPYQAQMLGDVD… |
| G7EJ38 | 80-501 | None |
| A0A5E7JMS7 | 29-488 | None |
| A0A7X5Z3G5 | 112-500 | None |
| A3Y5H2 | 100-502 | None |
| A3Y531 | 1-468 | None |
| A0A3N1NF15 | 10-388 | None |
| A0A1E3WNQ0 | 51-436 | None |
| A0A4Q6YVD5 | 288-687 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.