DPCstruct | MC53871
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 117 ± 6 aa |
| Standard deviation of domain lengths | 5.66 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 71.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 80.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X0MJN3 | 26-145 | GSQVASPTSPHPNNRTTSCVMCLSEAPECLVHLAVGCPFARRLWSALSPTPHPVFVDFVCPVVSRSERRLAELRVLFFHSIWKLCRR… |
| A0A238FN21 | 1-100 | MCLSEAPESLPHLAVGCPFARRLWAALSPSPHPIFADFVCPLVSRSERRIVELRILFFHSTWKLSRRRRFSSQPLEPITEAELEELG… |
| A0A238FP45 | 153-272 | None |
| A0A2X0MRI0 | 577-698 | None |
| A0A2X0LX03 | 201-318 | None |
| A0A2X0M020 | 228-346 | None |
| A0A2X0MFA1 | 69-186 | None |
| A0A238F331 | 47-166 | None |
| A0A238FBA5 | 151-266 | None |
| A0A238FHF9 | 92-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.