DPCstruct | MC5387
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 119 ± 24 aa |
| Standard deviation of domain lengths | 24.18 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 81.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 25.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D0AHF0 | 3-95 | NLNTSNPNHYIFETKHLKISILGGVRFNNLEALRVTLGIQKLKSEQVLRQNIDLYNDTSIEKLTRKVAERLEIGTTIVRRDLDSLTN… |
| A0A4R6J0I6 | 2-131 | KMNTENTNCFIYETEELLIELLGGVRIEGLDRMRVTMKVSVVNRKHPQYTNELADLAIRHNLDLYNDTQVEKFVRRVAEKLEVGSIA… |
| A0A1G0Z355 | 125-264 | None |
| A0A7D7ZUL1 | 2-123 | None |
| A0A3A3FF55 | 168-269 | None |
| A0A6B9Z5B8 | 3-123 | None |
| A0A3E1NJ27 | 3-126 | None |
| A0A5C5ZIM3 | 254-382 | None |
| A0A656QJX9 | 146-267 | None |
| A0A3D1KD18 | 170-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.