DPCstruct | MC53862
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 72 ± 12 aa |
| Standard deviation of domain lengths | 11.62 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.66 |
| Pfam Score | 85.89 |
| Assigned Pfam label(s) | CL0039- CL0740- CL0350 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C7IVI5 | 113-169 | RHIGEMEGIILEAESGDFLGKHCGFWFYTIGQRQGLRLPGGPWYVVEKDVKNNVVFV |
| A0A3Q0CM91 | 137-193 | YLQPRPGKFISIEDNKVLGTHKGWFLYTLGQRAKISGLKEPWYVVEKDGVKGDVLVA |
| A0A812P1I4 | 205-283 | None |
| A0A1B0C713 | 160-244 | None |
| A0A7R9Q653 | 169-225 | None |
| M0ZWZ1 | 18-95 | None |
| G5A1M8 | 179-255 | None |
| A0A6J3GHG5 | 79-158 | None |
| A0A0V0J2S9 | 5-74 | None |
| A0A853QXZ8 | 193-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.