DPCstruct | MC53856
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 171 ± 31 aa |
| Standard deviation of domain lengths | 30.58 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9DLG9 | 263-400 | KQDAALKSWGDLSESELMLAARLGIQTAAAWDEGTGKIWEVNWEQLSFLQRQAAQGLGFTPESWNAKDSRISQDPACEKSWAELTEE… |
| A0A813GQX7 | 219-442 | LGMTWVDLTSSKRDALVMLGWDPVGTRWNVQDFPESYASLWNGLQPRQQEAAAFLGFNPQVWEKCESASPCIIRKERLEKHWSTIQW… |
| L1IHB6 | 23-207 | None |
| A0A7R9W8L7 | 7-169 | None |
| A0A7S2Q552 | 310-467 | None |
| A0A2C6CP24 | 237-402 | None |
| A0A448Z490 | 13-174 | None |
| A0A7S0NC67 | 143-329 | None |
| B5YMR0 | 765-912 | None |
| K0RCQ6 | 78-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.