DPCstruct | MC53853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 89 |
|---|---|
| Mean domain length (aa) | 180 ± 25 aa |
| Standard deviation of domain lengths | 24.83 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.96 |
| Pfam Score | 98.98 |
| Assigned Pfam label(s) | PF00920- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9DGX7 | 721-910 | TSKALTQPKSQGASQAMLHAVGMKKEDLNKAQVGICSVWYQGNPCNMHLLSLGDDVKKEVDKDPKMYGFQFNTIGVSDGMSMGTKGM… |
| A0A845EV85 | 8-171 | KSKVFSEGSMKAPNRAMLRAVGVTDEDFKKPMIGVASTWSEVTPCNIHIDDLAIQAKEGAREAGGVPLIFNTITVSDGISMGTQGMR… |
| A0A0M9F6J5 | 35-219 | None |
| A0A251SF95 | 64-290 | None |
| A0A378AA27 | 2-119 | None |
| A0A7S4E837 | 61-245 | None |
| R9P8I1 | 214-412 | None |
| H0ESC2 | 1-138 | None |
| A0A1P8WEJ7 | 29-228 | None |
| A0A4T0GFF6 | 327-508 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.