DPCstruct | MC53851
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 304 ± 52 aa |
| Standard deviation of domain lengths | 51.72 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 69.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9DF24 | 22-255 | DDYSLRCLSNGEFQSIVFVKSISEAVFVNNLLRHIRQERIDLDAVAAHMHGPAPPDKHKESARFMQPLLGEIVSTIKTKAPPSASSS… |
| A0A812QI80 | 86-356 | NTVSGKKFYRNVQTTPWSSKAGLAGKDVNSIRLVDITRKGLDDYSLRNLSNGEFQGVVFVRSVSEALFTTNLLRLLRQDKVDLDKVA… |
| A0A1Q9C1J0 | 142-483 | None |
| A0A812X387 | 432-685 | None |
| A0A812VE78 | 194-478 | None |
| A0A812I0V6 | 206-481 | None |
| A0A1Q9D1T3 | 200-460 | None |
| A0A812MWQ2 | 251-626 | None |
| A0A1Q9C3X4 | 525-910 | None |
| A0A813ANQ9 | 213-557 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.