DPCstruct | MC53844
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 311 ± 35 aa |
| Standard deviation of domain lengths | 35.21 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 68.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0489 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A656HH31 | 336-609 | MKPANISASTEPSDKNKIAHSNKESFSLKPARKCIIKDCDGQGFGVYATAKISAKELIEECHLMPPITQDDFNNCSTAFPIDSFIYR… |
| A0A7V3CZP1 | 1-274 | MEKIIFYEIKETLEGKGLFAVCDVPAGQKITQYSGSIVAYEEIPAHWINHCMWMETDRWMIIESDGRYINHSCSPNCEVVEGNYAVT… |
| A0A1Q9CSC9 | 1-334 | None |
| A0A7R9ZX80 | 7-275 | None |
| A0A7S4SBK1 | 128-443 | None |
| A0A812I8B6 | 893-1243 | None |
| K1RHD7 | 295-650 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.