DPCstruct | MC53841
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 174 ± 26 aa |
| Standard deviation of domain lengths | 26.21 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 27.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q8B5R3 | 2-150 | IACESIPEEDESTRFAGFLLYNEQGWRQAFADHQNYWAWRRDRNESRWQQQERGELDFDTKNMMHTVRLLLSGRSLMKSGQPIVRFS… |
| A0A2W7ASM3 | 18-170 | YPLAEDLLPAVQYYTRSTNEFVTLLHNTQTYRQALQEYDAFQSWRKNRNSKRAEIEEKVGYDSKHSGHCYRLLKSGIEILNGDGVIP… |
| A0A238XF22 | 1-213 | None |
| A0A497P388 | 97-268 | None |
| A0A858RIP9 | 436-603 | None |
| A0A024FFQ6 | 1-169 | None |
| A0A2K8T0T6 | 75-225 | None |
| A0A2E2D6L8 | 145-371 | None |
| A0A7W7NXM1 | 126-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.