DPCstruct | MC53840
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 188 ± 17 aa |
| Standard deviation of domain lengths | 17.29 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00566 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B6MUD6 | 99-280 | NQLFGTTELPDKPILLPPFVDSAHRLSYHLTRKGRNVTDRVVCVLGFACPDITYSPAIYPIAALLLHFMSEEECYNSLASLVASKHK… |
| A0A3P7GUG0 | 1-179 | MLVGQEWADRRLQPTYHLNARGQAIHLAVLHDLAVSRPHVVYAPHVWPLTALMLHYLRPRTALACIRALLDAAPDERVAQSKSLWRS… |
| A0A7E4RRL8 | 26-212 | None |
| T1JNM3 | 85-275 | None |
| A0A0J7KW60 | 113-279 | None |
| A0A7M3QGP7 | 84-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.