DPCstruct | MC53837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 241 |
|---|---|
| Mean domain length (aa) | 66 ± 10 aa |
| Standard deviation of domain lengths | 9.90 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.33 |
| Pfam Score | 93.38 |
| Assigned Pfam label(s) | CL0229- CL0220- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3XDA5 | 5-69 | HAVQHPLKCEGCKREPIVGLRYKCTRCPRYNLCQDCFWTGITTDPHTNSHDVKEYTSATVSEWTT |
| A0A2J8R7K8 | 84-148 | VRHPNIICDCCKKHGLRGMRWKCRVCLDYDLCTQCYMHNKHELAHAFDRYETAHSRPVTLSPRQG |
| A0A1I8HX13 | 98-163 | None |
| A0A182TLE2 | 80-134 | None |
| A0A2C9JXE4 | 77-138 | None |
| A0A2C9JT16 | 106-170 | None |
| A0A2C9JL71 | 357-421 | None |
| A0A820UI45 | 703-760 | None |
| A0A835GVH0 | 28-110 | None |
| A0A1I8IV88 | 734-796 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.