DPCstruct | MC53833
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 118 ± 24 aa |
| Standard deviation of domain lengths | 24.34 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 80.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A314Z118 | 1-171 | MGSRGTQEAGISVTIITGLLVITGWILVAGTFILCGTFLLLHNVAADTCVAMNEWVQNPTAHTALDDILPCVDSATTQETLLRSKEV… |
| B9T8D6 | 14-115 | EEWVDHPHAVTALSNILPCVDQSTTNKTLVQSKEVINDIVNVVNTYIYTFANANPSPTEFNYYNQSGPFMPPLCYPFDSQLQDRQCG… |
| A0A6A3ASN2 | 416-554 | None |
| A0A452XCE4 | 1-105 | None |
| A0A816IJU6 | 38-134 | None |
| A0A2P6RIH5 | 316-420 | None |
| A0A2C9W3L2 | 33-138 | None |
| A0A368QWI3 | 11-119 | None |
| A0A4S4EJR4 | 192-304 | None |
| A0A427AY12 | 1-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.