DPCstruct | MC5383
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 232 ± 13 aa |
| Standard deviation of domain lengths | 12.79 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 76.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R2XS24 | 3-226 | GEFQLSAQQINKMNEITNKGSSNYAAGYDYLRQQIETFLNAPENASHPDRQAYQKVTFWLQKAAEINRNDPDSPANGYIRDVARSGL… |
| A0A7G6RNU1 | 1-215 | MAYQFTGSELSALQNAYNNAVAGGSWATVYSTISASISTNGQPEAGVDQAVLSWVNGAQQVNAGVGDFSHFIRQYSTAQYVLRFGEA… |
| Z9JN91 | 4-241 | None |
| A0A2K9NUD8 | 18-270 | None |
| A0A0F3IRT6 | 10-237 | None |
| A0A1W6ZEC3 | 4-222 | None |
| A0A2P7BBV7 | 123-354 | None |
| A0A5N1JPC6 | 3-229 | None |
| A0A427Q8B4 | 3-238 | None |
| A0A5E7K878 | 3-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.