DPCstruct | MC53829
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 105 ± 7 aa |
| Standard deviation of domain lengths | 6.75 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 63.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12049 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A314YT84 | 1-93 | MEYNPLYDVDKGFKVMPSSFHDISDVEFQDNWGRVWVDLGTADYFAVDVLLNCLTVLSSEYLGIQQIVFGGNRIGDWEEGMTNTEDG… |
| A0A834Z7P1 | 80-189 | GRLGGCNSMNMQLSQSPMDRRPSYDAIQGANVTPTTFYNIGDLEIQDNLARIWMDIGTSEPLLLDVLVNGLTQISSDYIGIKQLVFG… |
| M0YYL8 | 1-111 | None |
| A0A287V2C8 | 103-213 | None |
| A0A2U1LF19 | 155-264 | None |
| A0A2P5WBF1 | 139-241 | None |
| A0A1D6QAA4 | 105-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.