DPCstruct | MC53821
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 66 ± 6 aa |
| Standard deviation of domain lengths | 5.50 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 94.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 45.24 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF00557- CL0356 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815WN10 | 1-63 | EERPKLPQEPIWEYDVKFAGSTTAEKLSKVREKLKEYQVQHLIVHRTDDVVWLFNLRGADIPY |
| A0A131ZYM0 | 168-240 | RPARPSEPVVPLDLKFAGKTVNDKLAEIRQEMLKKDASLLILTALDDIAWILNLRGSDIEYNPVFFAYTILTM |
| B0WH45 | 268-330 | None |
| A0A2W1CSE1 | 280-339 | None |
| W4P3Z5 | 96-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.