DPCstruct | MC53820
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 104 ± 12 aa |
| Standard deviation of domain lengths | 11.77 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 50.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06830 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A314YC44 | 1-103 | MDIKVRPIGEEENRVHNYQIPADDTFAHLETQFRFSNLSDLVEGVLGKTYRPGYVSPVKVGVPMPMMGGEDKYQTSSLFSPLCKVCR… |
| M5W535 | 350-443 | AGLAEMDIKVRPIGEEENRVHKYQIPADDTFAHLETQFRFSNLSDLVEGVLGKTYRPGYVSPVKVGVPMPMMGGEDKYQTPSLFSTL… |
| A0A7J9G3F5 | 46-141 | None |
| A0A833RDK0 | 392-480 | None |
| A0A2U1Q8H6 | 65-163 | None |
| A0A165XTE5 | 760-854 | None |
| A0A4P1RDB3 | 538-640 | None |
| A0A2R6PZF8 | 48-163 | None |
| A0A438EPF0 | 67-190 | None |
| A0A287EDH5 | 1-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.