DPCstruct | MC53816
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 119 ± 12 aa |
| Standard deviation of domain lengths | 11.87 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 71.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0316 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A175YPR4 | 108-235 | FSLARFAQMMWRLNFLVFFCCLVLNNSYTLYYICPMHTLFTLMVYGALGIFNKYNENGTVIATKFIACLLVVIIIWEVPGVFDVVWS… |
| A0A0A9CUX0 | 1-105 | MMWRLNFFVAFCCIVLDNDYMLYYICPMHTLFTLMVYGCLGLFNKYNEIPSVMAMKIAGCFFAVILIWEIPGVFEILWAPFTFLLGY… |
| A0A453J3K4 | 45-174 | None |
| A0A5E4GE07 | 227-354 | None |
| A0A0A0KI47 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.