DPCstruct | MC53815
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 151 ± 20 aa |
| Standard deviation of domain lengths | 19.69 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 72.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 41.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9CU89 | 10-181 | EEKTDLERVINREKHRSTRMKLSREKVLHECRLLHERLQECSGKFLAEEQDNFSIDPSSLPDALDLLATSDNRVRLLVAEAQLLARD… |
| A0A6A2Z7P0 | 82-214 | DVEVQLEHERQTSKHVKTAREELLNECRLLHNSLLECNVNLSTDDENLIKDSSLVEEALDLLTTSDDKITLLLAEVQLLAKEDATAI… |
| A0A6J1JST3 | 391-533 | None |
| A0A7J7L7L7 | 1-148 | None |
| A0A1D6LQY8 | 189-360 | None |
| A0A0A9CLI1 | 384-555 | None |
| A0A5B6WDP0 | 81-253 | None |
| A0A2G2XZG3 | 389-548 | None |
| A0A6S7N5D4 | 458-594 | None |
| M0ZIZ4 | 480-640 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.