DPCstruct | MC5381
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 166 ± 24 aa |
| Standard deviation of domain lengths | 24.25 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C3M5X7 | 103-260 | ELPRRLFRRLAPKTSSDQWKDHDEPLPFLQYLFTIPDIPTPYIDSHDGYALTKAVHARFVPLIQYLLGQGASPARKHALAVTVAIRK… |
| A0A1E3HZX6 | 33-186 | RPLAVRELPRRLFRVSKPEPPIHPMITYLFETYSPSPNSHKGYPLCRAVLQHNLPLISFLLVHGADPSLKDFMAVEIAISMKDLQMV… |
| A0A4Z0AB14 | 7-148 | None |
| A0A0F7RWG9 | 1-218 | None |
| A0A427YBF9 | 219-379 | None |
| A0A409YD01 | 33-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.