DPCstruct | MC53808
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 150 ± 25 aa |
| Standard deviation of domain lengths | 25.10 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 23.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A533IZY8 | 11-166 | VIRTQAASSRFVRFYITTNTQSLAELNAFHFFGKGAVQYAFLAGWLAVIALTALAMTIAFRRHSGWRRWALVLLMPLGLTPTVAVNW… |
| A0A537C9J0 | 133-255 | IGLSANRVPARLEEINAFTLMHQSARHYLWFAFALLMPLITLTVAVRLITAKGMPRRWLWAFAALIASPAFVLNWTSGQVAVQNSLF… |
| A0A3D2VYX0 | 77-231 | None |
| U3GEW6 | 10-141 | None |
| A0A2U2BUF6 | 124-294 | None |
| A0A7T0R028 | 1-113 | None |
| H2CAB3 | 119-276 | None |
| A0A318BHI8 | 38-188 | None |
| A0A239ISN2 | 124-270 | None |
| A0A858R7F8 | 62-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.