DPCstruct | MC53802
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 103 ± 7 aa |
| Standard deviation of domain lengths | 7.20 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1JIH9 | 1-122 | MAGQAGLDPHARGRGDARPVAWGRRGAEARTEIPVYGRAYPEESAYEIPYQTVTPLQHMTKAGQSYAVADADPQTNYYYAKSYADRI… |
| A0A1H3I0M5 | 565-663 | VATPKAGKATIPVYGRAYPEAAAYPDGVPAQAIVPLQYTLAAGQRYAVGNILPSEYYRAVSFDGSAPGDRTVIRGELTYVQIQFGHR… |
| A0A499VLX7 | 1-101 | None |
| A0A2T0MNQ1 | 43-152 | None |
| A0A3N4YQL5 | 624-731 | None |
| A0A7Z0Q0U4 | 425-519 | None |
| A0A2P9I7K6 | 926-1019 | None |
| A0A559W7I6 | 173-276 | None |
| A0A2W6EAK7 | 108-211 | None |
| A0A7K2L379 | 83-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.