DPCstruct | MC53800
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 434 ± 70 aa |
| Standard deviation of domain lengths | 70.21 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0M0A5 | 112-598 | GMSGSPVYADDGSLIGAVSYGLAFGPSRVAGVTPAADMQALLDNAPSSATAQAALRKAEGADHVALPDRTADRIVDMGAATTAEADA… |
| A0A7X8CJA8 | 2-408 | EGIGKSVFYGTRIENFDVEVLDVVIGKDINQSYIVVKVTDEKIKKLGGISAGMSGSPIFFNGKLAGALAYSWETKDNLIGVVTPIEA… |
| A0A1F8EU92 | 1-500 | None |
| A0A7C6PLL9 | 115-709 | None |
| R7PU86 | 40-416 | None |
| A0A6N6S366 | 60-429 | None |
| A0A257LV41 | 72-451 | None |
| A0A1F8F5G1 | 1-367 | None |
| A0A1G3BQH5 | 1-344 | None |
| A0A3N5WKV0 | 88-579 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.