DPCstruct | MC5380
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 215 ± 27 aa |
| Standard deviation of domain lengths | 26.92 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 29.36 |
| Pfam Score | 98.53 |
| Assigned Pfam label(s) | PF07798- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A077W7F3 | 3-177 | FFDADRFARLLEREGFSSGQARAVINALDDVVDESTIIVTADLVSKADQERTIKQYKEDFARLKNEIQQMEGRDVAEVKTANERLKS… |
| A0A1E3HQD7 | 1-264 | MPRLPLGPLRPLLLRRAPRASQRRPITIHAPGPSTDHPDYSEQTIITQAPSDSSDHPHYQATPGLVASTSLPAPPESPRFTPRHLQH… |
| A0A4Y9ZBS6 | 3-188 | None |
| A0A225B8P4 | 44-304 | None |
| A0A0G4KJZ8 | 705-957 | None |
| A0A177W971 | 17-242 | None |
| A0A6P4B1X4 | 33-205 | None |
| A0A5S9X447 | 11-164 | None |
| A0A4V5NAR1 | 443-657 | None |
| R7U2J8 | 3-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.