DPCstruct | MC538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 139 ± 9 aa |
| Standard deviation of domain lengths | 8.86 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 31.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0714 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A231NWE5 | 1-158 | MFISGIKIKSNNNRIRKTIVVYLLLALVAVAVNLIYGFFGHGVRAAAMTWMFLYPLLGGALGYLLIGRYLAFITRFVVYRMGYNSYN… |
| A0A2G6G4T8 | 217-351 | RNVAEMAFVYLIFGLAAGIFFREFSKAYDFSGSSSLANMHGHLIALGVIGLLIVYALLIVLQPKNPQLVKKMKLPLLLWHIGLSISV… |
| A0A516PW48 | 2-138 | None |
| A0A2A4HCG3 | 2-140 | None |
| S9ULP6 | 21-168 | None |
| A0A0E1V9Q6 | 2-122 | None |
| A0A1C7FKT1 | 9-146 | None |
| A0A412J4U0 | 2-127 | None |
| A0A1G7QBV5 | 2-140 | None |
| A0A504Y4F2 | 346-487 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.