DPCstruct | MC53793
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 149 ± 17 aa |
| Standard deviation of domain lengths | 17.17 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 46.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0713 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E5UNS2 | 12-148 | FLMHLLIIFLSIIVMEIVAIFAHKYIMHGPGWFLHKSHHKKHNNKFELNDLYFIFFSIPSIYCIYFGFSNQNFILTSIGIGTLCYGL… |
| A9RNT1 | 2-141 | EYWARWAHKALWHDSLWNMHESHHRPREGPFEMNDIFAIINAVPAISLMAYGFFHKGLVPGLCFGAGLGITMFGMAYMFVHDGLVHR… |
| A0A0D9VNW9 | 23-198 | None |
| A0A7V9GGE2 | 3-148 | None |
| A0A2G5E133 | 153-320 | None |
| A0A0E0PD30 | 356-523 | None |
| A7MJV6 | 71-221 | None |
| A0A654C2S4 | 95-244 | None |
| A0A4U1CWW9 | 6-150 | None |
| K8F184 | 143-330 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.