DPCstruct | MC5379
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1197 |
|---|---|
| Mean domain length (aa) | 149 ± 24 aa |
| Standard deviation of domain lengths | 24.36 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 15.90 |
| Pfam Score | 86.92 |
| Assigned Pfam label(s) | CL0023- CL0123- PF06918- CL0306- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L8YCQ6 | 372-528 | MEEAILEGLRALGLADYLGGPFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFSFTVMQVTATLGARAVKVFEEAKPNSELCCKPLC… |
| A0A1E3HGK4 | 19-173 | RAGRVLRHQLDGVAYSDDTPQQEEDSLLITINFSIDYSNPSKSLQGQHKSVGVIMGQVAELPNVYHTKFHYNLMLGMTPAPSEPPSH… |
| A0A2N0QS73 | 99-239 | None |
| A0A2N0QRI0 | 54-195 | None |
| A0A2N0PXR7 | 141-285 | None |
| A0A819Q8V2 | 421-570 | None |
| A0A819MRY8 | 233-361 | None |
| A0A6D2JMA4 | 30-172 | None |
| A0A2B4S452 | 38-199 | None |
| A0A835CS87 | 9-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.