DPCstruct | MC53789
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 120 ± 9 aa |
| Standard deviation of domain lengths | 8.88 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5FM61 | 2-112 | MPTFKIKGKVNEKVSGTAFVPFVRGDNGDHPVLVTARHVLESIEGEKAQVFMRKKRENGSCQKVLCDISIRDVVSPIWVSHPDVSID… |
| A0A177W0Z1 | 5-134 | YTHPVELLIHSTTRIMSETSTGLISTGTGYYFNFAADGGNSIPCIVTNKHVVHGAVKGKFCLNKKNSDGSIDLGGHISLEFSNFESR… |
| A0A538Q113 | 366-489 | None |
| A0A2M8G796 | 26-148 | None |
| A0A0S8H5H8 | 5-115 | None |
| A0A416NLQ2 | 1-129 | None |
| A0A5B8FHL0 | 113-236 | None |
| D8IYW7 | 1-132 | None |
| A0A3B8XIH9 | 10-115 | None |
| A0A7X4AQ63 | 10-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.