DPCstruct | MC53786
Metacluster Properties and Pfam Annotations
| Number of structural domains | 182 |
|---|---|
| Mean domain length (aa) | 190 ± 43 aa |
| Standard deviation of domain lengths | 42.57 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 72.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 15.06 |
| Pfam Score | 66.29 |
| Assigned Pfam label(s) | PF03743- PF10038- PF12508 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7JEC4 | 159-293 | QGSIGTIPAGTVVPVKLSNYISSQSSQSGEIYTASAPQNYVTKDKFILIYKGSNLKGQLLDVRSGKWFVRNGVLVLDNSLITTNNDQ… |
| A0A7V3E5D8 | 15-190 | LEPWAGLTNPPPQKGKYFLHTGFMFDAVLQTAIFSYNLESPVIAETEFDIIYLDKVMIPKGTKIIGYASVLKSADRVNVFFHTMVFP… |
| A0A7W1BFH1 | 43-195 | None |
| A0A1H6K328 | 1-235 | None |
| A0A7W1EQ57 | 10-199 | None |
| A0A809NC15 | 173-426 | None |
| A0A2T2RQZ7 | 112-368 | None |
| A0A1F6RDJ7 | 3-160 | None |
| A0A6J4NP02 | 226-442 | None |
| A0A2V8WTR2 | 17-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.