DPCstruct | MC53783
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 79 ± 9 aa |
| Standard deviation of domain lengths | 8.59 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 39.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3CGW9 | 1-88 | MINFTKITSLYDYQEDYRVESYLSRARYNYEGKYFAEASIRRDGSSRFSADNRWGNFWSLGGSWIVSKEDFFKNALNTVNDLKVRASY |
| A0A090PN92 | 148-222 | LLSGLARVNYGYDNKYLLSFAARVDGSSLFGPNNKYGFFPSASAGWNVHNEKFFNENISFLNQLKLRASYGVVGN |
| S7VGA6 | 516-594 | None |
| A0A642MBQ0 | 409-485 | None |
| A0A376DR75 | 414-484 | None |
| A0A1Q7ZRJ6 | 540-610 | None |
| U2L4F4 | 18-109 | None |
| A0A4P8MNN7 | 216-290 | None |
| A0A132HK60 | 459-531 | None |
| A0A090WUP7 | 19-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.