DPCstruct | MC53781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 109 ± 9 aa |
| Standard deviation of domain lengths | 9.43 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3CAJ7 | 1-119 | MSRLRLTILFIVQLLIFEAFSQEEKNNYKIIFNTPSINETGNVPIGNGSLGSNVWVEENGDLLYLSRNDSHSELQRLLKLGRVRISF… |
| A0A2J6NBC9 | 1-97 | MVWDSPSKDTWGTMPCGNGDIGLNVWVEESGDLLFYIGKTDSWDDNCRLLKVGRVRIKLNPNSLARSKTFKQVLNLGDGAIEISLGE… |
| A0A3D1BQ49 | 6-131 | None |
| A0A4R8DHB7 | 473-576 | None |
| E2NCH4 | 1-112 | None |
| A0A069D011 | 7-100 | None |
| A0A1U9NMK4 | 212-319 | None |
| A0A662AXU7 | 4-121 | None |
| A0A174S0W2 | 1-105 | None |
| A0A093V6S5 | 8-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.